Definition, Betydelse & Synonymer | Engelska ordet ISOLEUCINE


ISOLEUCINE

Definition av ISOLEUCINE

  1. (biokemi) aminosyran isoleucin

1
ILE

Antal bokstäver

10

Är palindrom

Nej

19
CI
CIN
EU
IN
IS
ISO
LE

1

1

2

CE
CEE
CEI


Sök efter ISOLEUCINE på:



Exempel på hur man kan använda ISOLEUCINE i en mening

  • In plants and bacteria, isoleucine is synthesized from a pyruvate employing leucine biosynthesis enzymes.
  • Of the 21 amino acids common to all life forms, the nine amino acids humans cannot synthesize are valine, isoleucine, leucine, methionine, phenylalanine, tryptophan, threonine, histidine, and lysine.
  • Gunnerale characters shared with the core of the eudicots are cyanogenesis via phenylalanine, metabolic pathways of isoleucine or valine, presence of the DNA sequence of PI-dB motif, 9 and is common to suffer a small deletion in the sequence of 18S ribosomal DNA.
  • Homoalanine is biosynthesised by transaminating oxobutyrate, a metabolite in isoleucine biosynthesis.
  • Specifically restricting consumption of the three branched-chain amino acids leucine, isoleucine and valine is sufficient to promote leanness and improve regulation of blood glucose.
  • As herbicides sulfonylureas function by interfering with biosynthesis of the amino acids valine, isoleucine, and leucine, specifically via acetolactate synthase inhibition.
  • The positions in the heptad repeat are usually labeled abcdefg, where a and d are the hydrophobic positions, often being occupied by isoleucine, leucine, or valine.
  • Amino acids (300 mg glutamine; 200 mg arginine; 50 mg each asparagine, cystine, leucine, and isoleucine; 40 mg lysine hydrochloride; 30 mg serine; 20 mg each aspartic acid, glutamic acid, hydroxyproline, proline, threonine, tyrosine, and valine; 15 mg each histidine, methionine, and phenylalanine; 10 mg glycine; 5 mg tryptophan; and 1 mg reduced glutathione).
  • X is L-valine or L-isoleucine – in natural gramicidin mixes of A, B and C, about 5% of the total gramicidins are isoleucine isoforms.
  • The result was twelve protein-like amino acids: aspartic acid, glutamic acid, glycine, alanine, valine, leucine, isoleucine, serine, threonine, proline, tyrosine, and phenylalanine.
  • Homoserine is an intermediate in the biosynthesis of three essential amino acids: methionine, threonine (an isomer of homoserine), and isoleucine.
  • Additionally, it is suggested that the amino acids lysine, arginine, histidine, leucine, isoleucine, valine and phenylalanine may replace the canonical purpose of PHA as an energy substrate during oxic conditions, based on genomic potential and similarity to behavior of other microbial metabolisms.
  • In general, all L designated amino acids are enantiomers of their D counterparts except for isoleucine and threonine which contain two carbon stereocenters, making them diastereomers.
  • By comparison to these farmed meats, kangaroo meat is higher in threonine, isoleucine and valine and lower in arginine and methionine-cystine amino acids.
  • In this case however, the authors credited branched aliphatic amino acids (valine, leucine, and isoleucine) for foldon stability.
  • MCM resides in the mitochondria, where a number of substances, including the branched-chain amino acids isoleucine and valine, as well as methionine, threonine, thymine and odd-chain fatty acids, are metabolized via methylmalonate semialdehyde (MMlSA) or propionyl-CoA (Pr-CoA) to a common compound - methylmalonyl-CoA (MMl-CoA).
  • Lepirudin is almost identical to hirudin extracted from Hirudo medicinalis, having the amino acid sequence LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ with disulfide bridges at Cys6-Cys14, Cys16-Cys28 and Cys22-Cys39, and differs from by the substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63.
  • Editing results in a codon alteration from ATT to GTT, resulting in an amino acid change from isoleucine to valine.
  • HMG-CoA is a metabolic intermediate in the metabolism of the branched-chain amino acids, which include leucine, isoleucine, and valine.
  • The 80-amino acid helical component of each triple peptide contain many Gly-X-Y sequences, where X and Y are proline, isoleucine, or hydroxylysine; they, therefore, strongly resemble collagen fibrils.


Förberedelsen av sidan tog: 298,49 ms.